Anti AKAIN1 pAb (ATL-HPA049365)

Atlas Antibodies

SKU:
ATL-HPA049365-25
  • Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: A-kinase anchor inhibitor 1
Gene Name: AKAIN1
Alternative Gene Name: C18orf42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091636: 72%, ENSRNOG00000053805: 75%
Entrez Gene ID: 642597
Uniprot ID: P0CW23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FWLGEKPGNEPEEVKLQNASKQIVQNAILQAVQQVSQESQRREERISDNRDHIQLGVGELTKKHEKK
Gene Sequence FWLGEKPGNEPEEVKLQNASKQIVQNAILQAVQQVSQESQRREERISDNRDHIQLGVGELTKKHEKK
Gene ID - Mouse ENSMUSG00000091636
Gene ID - Rat ENSRNOG00000053805
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AKAIN1 pAb (ATL-HPA049365)
Datasheet Anti AKAIN1 pAb (ATL-HPA049365) Datasheet (External Link)
Vendor Page Anti AKAIN1 pAb (ATL-HPA049365) at Atlas Antibodies

Documents & Links for Anti AKAIN1 pAb (ATL-HPA049365)
Datasheet Anti AKAIN1 pAb (ATL-HPA049365) Datasheet (External Link)
Vendor Page Anti AKAIN1 pAb (ATL-HPA049365)