Protein Description: adenylate kinase 3
Gene Name: AK3
Alternative Gene Name: AK3L1, AK6, AKL3L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024782: 92%, ENSRNOG00000052506: 93%
Entrez Gene ID: 50808
Uniprot ID: Q9UIJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AK3
Alternative Gene Name: AK3L1, AK6, AKL3L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024782: 92%, ENSRNOG00000052506: 93%
Entrez Gene ID: 50808
Uniprot ID: Q9UIJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLD |
Documents & Links for Anti AK3 pAb (ATL-HPA063324 w/enhanced validation) | |
Datasheet | Anti AK3 pAb (ATL-HPA063324 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AK3 pAb (ATL-HPA063324 w/enhanced validation) at Atlas |
Documents & Links for Anti AK3 pAb (ATL-HPA063324 w/enhanced validation) | |
Datasheet | Anti AK3 pAb (ATL-HPA063324 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AK3 pAb (ATL-HPA063324 w/enhanced validation) |