Anti AK3 pAb (ATL-HPA063324 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA063324-25
  • Immunohistochemistry analysis in human kidney and pancreas tissues using Anti-AK3 antibody. Corresponding AK3 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added

Product Description

Protein Description: adenylate kinase 3
Gene Name: AK3
Alternative Gene Name: AK3L1, AK6, AKL3L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024782: 92%, ENSRNOG00000052506: 93%
Entrez Gene ID: 50808
Uniprot ID: Q9UIJ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLD
Gene Sequence GKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLD
Gene ID - Mouse ENSMUSG00000024782
Gene ID - Rat ENSRNOG00000052506
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti AK3 pAb (ATL-HPA063324 w/enhanced validation)
Datasheet Anti AK3 pAb (ATL-HPA063324 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AK3 pAb (ATL-HPA063324 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AK3 pAb (ATL-HPA063324 w/enhanced validation)
Datasheet Anti AK3 pAb (ATL-HPA063324 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AK3 pAb (ATL-HPA063324 w/enhanced validation)