Anti AHSA2 pAb (ATL-HPA051137)

Atlas Antibodies

SKU: ATL-HPA051137-25

• 
• 

Protein Description: AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast)
Gene Name: AHSA2
Alternative Gene Name: DKFZp564C236, Hch1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020288: 77%, ENSRNOG00000052142: 78%
Entrez Gene ID: 130872
Uniprot ID: Q719I0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGNITGEYLGLLTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQKQHFEEIKGSLQLT
• Gene Sequence: DGNITGEYLGLLTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQKQHFEEIKGSLQLT
• Gene ID - Mouse: ENSMUSG00000020288
• Gene ID - Rat: ENSRNOG00000052142
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.