![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100120/179899/atl-hpa067849_anti-ago1-pab-atl-hpa067849_61562__96511.1681135742.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: argonaute 1, RISC catalytic component
Gene Name: AGO1
Alternative Gene Name: EIF2C1, hAGO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041530: 100%, ENSRNOG00000055915: 100%
Entrez Gene ID: 26523
Uniprot ID: Q9UL18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AGO1
Alternative Gene Name: EIF2C1, hAGO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041530: 100%, ENSRNOG00000055915: 100%
Entrez Gene ID: 26523
Uniprot ID: Q9UL18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEIS |
| Documents & Links for Anti AGO1 pAb (ATL-HPA067849) | |
| Datasheet | Anti AGO1 pAb (ATL-HPA067849) Datasheet (External Link) |
| Vendor Page | Anti AGO1 pAb (ATL-HPA067849) at Atlas |
| Documents & Links for Anti AGO1 pAb (ATL-HPA067849) | |
| Datasheet | Anti AGO1 pAb (ATL-HPA067849) Datasheet (External Link) |
| Vendor Page | Anti AGO1 pAb (ATL-HPA067849) |