Protein Description: ArfGAP with FG repeats 2
Gene Name: AGFG2
Alternative Gene Name: HRBL, RABR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029722: 82%, ENSRNOG00000001404: 86%
Entrez Gene ID: 3268
Uniprot ID: O95081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AGFG2
Alternative Gene Name: HRBL, RABR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029722: 82%, ENSRNOG00000001404: 86%
Entrez Gene ID: 3268
Uniprot ID: O95081
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLADIGGDPFAAPQMAPAF |
Documents & Links for Anti AGFG2 pAb (ATL-HPA073562) | |
Datasheet | Anti AGFG2 pAb (ATL-HPA073562) Datasheet (External Link) |
Vendor Page | Anti AGFG2 pAb (ATL-HPA073562) at Atlas |
Documents & Links for Anti AGFG2 pAb (ATL-HPA073562) | |
Datasheet | Anti AGFG2 pAb (ATL-HPA073562) Datasheet (External Link) |
Vendor Page | Anti AGFG2 pAb (ATL-HPA073562) |