Protein Description: advanced glycosylation end-product specific receptor
Gene Name: AGER
Alternative Gene Name: RAGE, SCARJ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015452: 92%, ENSRNOG00000000439: 89%
Entrez Gene ID: 177
Uniprot ID: Q15109
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AGER
Alternative Gene Name: RAGE, SCARJ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015452: 92%, ENSRNOG00000000439: 89%
Entrez Gene ID: 177
Uniprot ID: Q15109
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNG |
| Documents & Links for Anti AGER pAb (ATL-HPA069474 w/enhanced validation) | |
| Datasheet | Anti AGER pAb (ATL-HPA069474 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AGER pAb (ATL-HPA069474 w/enhanced validation) at Atlas |
| Documents & Links for Anti AGER pAb (ATL-HPA069474 w/enhanced validation) | |
| Datasheet | Anti AGER pAb (ATL-HPA069474 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AGER pAb (ATL-HPA069474 w/enhanced validation) |