Anti AGER pAb (ATL-HPA069474 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA069474-25

• 

Protein Description: advanced glycosylation end-product specific receptor
Gene Name: AGER
Alternative Gene Name: RAGE, SCARJ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015452: 92%, ENSRNOG00000000439: 89%
Entrez Gene ID: 177
Uniprot ID: Q15109
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNG
• Gene Sequence: QRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNG
• Gene ID - Mouse: ENSMUSG00000015452
• Gene ID - Rat: ENSRNOG00000000439
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.