Anti AEN pAb (ATL-HPA048599 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048599-100

• 
• 

Protein Description: apoptosis enhancing nuclease
Gene Name: AEN
Alternative Gene Name: FLJ12484, FLJ12562, ISG20L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030609: 62%, ENSRNOG00000018421: 62%
Entrez Gene ID: 64782
Uniprot ID: Q8WTP8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLPTPFGAATATEAASSGKQCLRAGSGSAP
• Gene Sequence: SLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLPTPFGAATATEAASSGKQCLRAGSGSAP
• Gene ID - Mouse: ENSMUSG00000030609
• Gene ID - Rat: ENSRNOG00000018421
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.