Anti AEBP1 pAb (ATL-HPA047724)
Atlas Antibodies
- SKU:
- ATL-HPA047724-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: AEBP1
Alternative Gene Name: ACLP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020473: 75%, ENSRNOG00000013720: 77%
Entrez Gene ID: 165
Uniprot ID: Q8IUX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEKGKDH |
Gene Sequence | PPVKPLLPPLPPDYGDGYVIPNYDDMDYYFGPPPPQKPDAERQTDEEKEELKKPKKEDSSPKEETDKWAVEKGKDH |
Gene ID - Mouse | ENSMUSG00000020473 |
Gene ID - Rat | ENSRNOG00000013720 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AEBP1 pAb (ATL-HPA047724) | |
Datasheet | Anti AEBP1 pAb (ATL-HPA047724) Datasheet (External Link) |
Vendor Page | Anti AEBP1 pAb (ATL-HPA047724) at Atlas Antibodies |
Documents & Links for Anti AEBP1 pAb (ATL-HPA047724) | |
Datasheet | Anti AEBP1 pAb (ATL-HPA047724) Datasheet (External Link) |
Vendor Page | Anti AEBP1 pAb (ATL-HPA047724) |