Anti ADIPOQ pAb (ATL-HPA051767)

Atlas Antibodies

SKU: ATL-HPA051767-100

• 
• 

Protein Description: adiponectin, C1Q and collagen domain containing
Gene Name: ADIPOQ
Alternative Gene Name: ACDC, ACRP30, adiponectin, AdipoQ, apM1, GBP28
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022878: 92%, ENSRNOG00000001821: 92%
Entrez Gene ID: 9370
Uniprot ID: Q15848
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL
• Gene Sequence: YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL
• Gene ID - Mouse: ENSMUSG00000022878
• Gene ID - Rat: ENSRNOG00000001821
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.