Anti ADH1A pAb (ATL-HPA060902)

Atlas Antibodies

SKU: ATL-HPA060902-25

• 

Protein Description: alcohol dehydrogenase 1A (class I), alpha polypeptide
Gene Name: ADH1A
Alternative Gene Name: ADH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074207: 62%, ENSRNOG00000012436: 67%
Entrez Gene ID: 124
Uniprot ID: P07327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHF
• Gene Sequence: IPQCGKCRICKNPESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHF
• Gene ID - Mouse: ENSMUSG00000074207
• Gene ID - Rat: ENSRNOG00000012436
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.