Protein Description: adhesion G protein-coupled receptor V1
Gene Name: ADGRV1
Alternative Gene Name: DKFZp761P0710, FEB4, GPR98, KIAA0686, MASS1, USH2C, VLGR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069170: 87%, ENSRNOG00000016306: 85%
Entrez Gene ID: 84059
Uniprot ID: Q8WXG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ADGRV1
Alternative Gene Name: DKFZp761P0710, FEB4, GPR98, KIAA0686, MASS1, USH2C, VLGR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069170: 87%, ENSRNOG00000016306: 85%
Entrez Gene ID: 84059
Uniprot ID: Q8WXG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA |
Gene ID - Mouse | ENSMUSG00000069170 |
Gene ID - Rat | ENSMUSG00000069170 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADGRV1 pAb (ATL-HPA067503) | |
Datasheet | Anti ADGRV1 pAb (ATL-HPA067503) Datasheet (External Link) |
Vendor Page | Anti ADGRV1 pAb (ATL-HPA067503) at Atlas |
Documents & Links for Anti ADGRV1 pAb (ATL-HPA067503) | |
Datasheet | Anti ADGRV1 pAb (ATL-HPA067503) Datasheet (External Link) |
Vendor Page | Anti ADGRV1 pAb (ATL-HPA067503) |