Anti ADGRV1 pAb (ATL-HPA067503)

Catalog No:
ATL-HPA067503-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: adhesion G protein-coupled receptor V1
Gene Name: ADGRV1
Alternative Gene Name: DKFZp761P0710, FEB4, GPR98, KIAA0686, MASS1, USH2C, VLGR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069170: 87%, ENSRNOG00000016306: 85%
Entrez Gene ID: 84059
Uniprot ID: Q8WXG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA
Gene ID - Mouse ENSMUSG00000069170
Gene ID - Rat ENSMUSG00000069170
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti ADGRV1 pAb (ATL-HPA067503)
Datasheet Anti ADGRV1 pAb (ATL-HPA067503) Datasheet (External Link)
Vendor Page Anti ADGRV1 pAb (ATL-HPA067503) at Atlas

Documents & Links for Anti ADGRV1 pAb (ATL-HPA067503)
Datasheet Anti ADGRV1 pAb (ATL-HPA067503) Datasheet (External Link)
Vendor Page Anti ADGRV1 pAb (ATL-HPA067503)