Anti ADGRE1 pAb (ATL-HPA052809)

Atlas Antibodies

SKU:
ATL-HPA052809-25
  • Immunohistochemical staining of human bone marrow shows cytoplasmic positivity in hematopoietic cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: adhesion G protein-coupled receptor E1
Gene Name: ADGRE1
Alternative Gene Name: EMR1, TM7LN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004730: 76%, ENSRNOG00000046254: 68%
Entrez Gene ID: 2015
Uniprot ID: Q14246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMAN
Gene Sequence MNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMAN
Gene ID - Mouse ENSMUSG00000004730
Gene ID - Rat ENSRNOG00000046254
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADGRE1 pAb (ATL-HPA052809)
Datasheet Anti ADGRE1 pAb (ATL-HPA052809) Datasheet (External Link)
Vendor Page Anti ADGRE1 pAb (ATL-HPA052809) at Atlas Antibodies

Documents & Links for Anti ADGRE1 pAb (ATL-HPA052809)
Datasheet Anti ADGRE1 pAb (ATL-HPA052809) Datasheet (External Link)
Vendor Page Anti ADGRE1 pAb (ATL-HPA052809)