Anti ADCYAP1R1 pAb (ATL-HPA049877 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049877-100

• 
• 
• 

Protein Description: adenylate cyclase activating polypeptide 1 (pituitary) receptor type I
Gene Name: ADCYAP1R1
Alternative Gene Name: PAC1, PAC1R, PACAPR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029778: 89%, ENSRNOG00000012098: 89%
Entrez Gene ID: 117
Uniprot ID: P41586
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWD
• Gene Sequence: SDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWD
• Gene ID - Mouse: ENSMUSG00000029778
• Gene ID - Rat: ENSRNOG00000012098
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.