Anti ADCK1 pAb (ATL-HPA055014)

Atlas Antibodies

SKU:
ATL-HPA055014-25
  • Immunohistochemical staining of human spleen shows strong cytoplasmic positivity in cells in red pulp.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aarF domain containing kinase 1
Gene Name: ADCK1
Alternative Gene Name: FLJ39600
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021044: 84%, ENSRNOG00000012685: 82%
Entrez Gene ID: 57143
Uniprot ID: Q86TW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SWDSVNRGISQAPVTATEDLEIRNNAANYLPQISHLLNHVPRQMLLILKTNDLLRGIEAALGTRASASSFLNMSRCCIRALAEHKKKNTCSFFRRTQI
Gene Sequence SWDSVNRGISQAPVTATEDLEIRNNAANYLPQISHLLNHVPRQMLLILKTNDLLRGIEAALGTRASASSFLNMSRCCIRALAEHKKKNTCSFFRRTQI
Gene ID - Mouse ENSMUSG00000021044
Gene ID - Rat ENSRNOG00000012685
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADCK1 pAb (ATL-HPA055014)
Datasheet Anti ADCK1 pAb (ATL-HPA055014) Datasheet (External Link)
Vendor Page Anti ADCK1 pAb (ATL-HPA055014) at Atlas Antibodies

Documents & Links for Anti ADCK1 pAb (ATL-HPA055014)
Datasheet Anti ADCK1 pAb (ATL-HPA055014) Datasheet (External Link)
Vendor Page Anti ADCK1 pAb (ATL-HPA055014)