Anti ADCK1 pAb (ATL-HPA051012)

Atlas Antibodies

SKU: ATL-HPA051012-25

• 
• 

Protein Description: aarF domain containing kinase 1
Gene Name: ADCK1
Alternative Gene Name: FLJ39600
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021044: 93%, ENSRNOG00000030334: 30%
Entrez Gene ID: 57143
Uniprot ID: Q86TW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YDYLTSLKSVPYGSEEYLQLRSKVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQVIRGDLGKE
• Gene Sequence: YDYLTSLKSVPYGSEEYLQLRSKVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAPQSSMQEIRQVIRGDLGKE
• Gene ID - Mouse: ENSMUSG00000021044
• Gene ID - Rat: ENSRNOG00000030334
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADCK1 pAb (ATL-HPA051012) – 1 Found

Ji, Yong; Liu, Yiqian; Sun, Changchun; Yu, Lijiang; Wang, Zhao; Du, Xu; Yang, Wu; Zhang, Chenggong; Tao, Chunmu; Wang, Jianjiang; Yang, Xi; Di, Sun; Huang, Yufeng. ADCK1 activates the β-catenin/TCF signaling pathway to promote the growth and migration of colon cancer cells. Cell Death & Disease. 2021;12(4):354.