Anti ADAMTSL1 pAb (ATL-HPA057437)

Catalog No:
ATL-HPA057437-25
$303.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: ADAMTS-like 1
Gene Name: ADAMTSL1
Alternative Gene Name: ADAMTSR1, C9orf94, FLJ35283
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066113: 90%, ENSRNOG00000006956: 89%
Entrez Gene ID: 92949
Uniprot ID: Q8N6G6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence QVPTQLEDIRALLAATGPNLPSVLTSPLGTQLVLDPGNSALLGCPIKGHPVPNITWFHGGQPIVTATGLTHHILAAGQILQVANLSGGSQGEFSCLAQNEAGVLMQKASLVIQDYWWSVDRLATCS
Gene ID - Mouse ENSMUSG00000066113
Gene ID - Rat ENSMUSG00000066113
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti ADAMTSL1 pAb (ATL-HPA057437)
Datasheet Anti ADAMTSL1 pAb (ATL-HPA057437) Datasheet (External Link)
Vendor Page Anti ADAMTSL1 pAb (ATL-HPA057437) at Atlas

Documents & Links for Anti ADAMTSL1 pAb (ATL-HPA057437)
Datasheet Anti ADAMTSL1 pAb (ATL-HPA057437) Datasheet (External Link)
Vendor Page Anti ADAMTSL1 pAb (ATL-HPA057437)