Anti ADAMTS7 pAb (ATL-HPA048453)

Atlas Antibodies

SKU: ATL-HPA048453-25

• 

Protein Description: ADAM metallopeptidase with thrombospondin type 1 motif, 7
Gene Name: ADAMTS7
Alternative Gene Name: ADAM-TS7, DKFZp434H204
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032363: 35%, ENSRNOG00000000695: 36%
Entrez Gene ID: 11173
Uniprot ID: Q9UKP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WDLQTVAVWGTFLPTTLTGLGHTPEPALNPGPKGQPESLSPEVPLSSRLLSM
• Gene Sequence: WDLQTVAVWGTFLPTTLTGLGHTPEPALNPGPKGQPESLSPEVPLSSRLLSM
• Gene ID - Mouse: ENSMUSG00000032363
• Gene ID - Rat: ENSRNOG00000000695
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.