Anti ADAMTS7 pAb (ATL-HPA045284)
Atlas Antibodies
- SKU:
- ATL-HPA045284-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ADAMTS7
Alternative Gene Name: ADAM-TS7, DKFZp434H204
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032363: 76%, ENSRNOG00000028036: 71%
Entrez Gene ID: 11173
Uniprot ID: Q9UKP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN |
Gene Sequence | LGRAHIRAHTPACHLLGEVQDSELEGGLAAISACDGLKGVFLLSN |
Gene ID - Mouse | ENSMUSG00000032363 |
Gene ID - Rat | ENSRNOG00000028036 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ADAMTS7 pAb (ATL-HPA045284) | |
Datasheet | Anti ADAMTS7 pAb (ATL-HPA045284) Datasheet (External Link) |
Vendor Page | Anti ADAMTS7 pAb (ATL-HPA045284) at Atlas Antibodies |
Documents & Links for Anti ADAMTS7 pAb (ATL-HPA045284) | |
Datasheet | Anti ADAMTS7 pAb (ATL-HPA045284) Datasheet (External Link) |
Vendor Page | Anti ADAMTS7 pAb (ATL-HPA045284) |