Anti ADAM22 pAb (ATL-HPA050325)

Atlas Antibodies

SKU:
ATL-HPA050325-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to cell junctions.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ADAM metallopeptidase domain 22
Gene Name: ADAM22
Alternative Gene Name: MDC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040537: 91%, ENSRNOG00000042478: 96%
Entrez Gene ID: 53616
Uniprot ID: Q9P0K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI
Gene Sequence LSPAKSPSSSTGSIASSRKYPYPMPPLPDEDKKVNRQSARLWETSI
Gene ID - Mouse ENSMUSG00000040537
Gene ID - Rat ENSRNOG00000042478
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ADAM22 pAb (ATL-HPA050325)
Datasheet Anti ADAM22 pAb (ATL-HPA050325) Datasheet (External Link)
Vendor Page Anti ADAM22 pAb (ATL-HPA050325) at Atlas Antibodies

Documents & Links for Anti ADAM22 pAb (ATL-HPA050325)
Datasheet Anti ADAM22 pAb (ATL-HPA050325) Datasheet (External Link)
Vendor Page Anti ADAM22 pAb (ATL-HPA050325)