Anti ADAM17 pAb (ATL-HPA051575)

Atlas Antibodies

SKU: ATL-HPA051575-25

• 
• 

Protein Description: ADAM metallopeptidase domain 17
Gene Name: ADAM17
Alternative Gene Name: CD156B, cSVP, TACE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052593: 97%, ENSRNOG00000060694: 96%
Entrez Gene ID: 6868
Uniprot ID: P78536
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
• Gene Sequence: KSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
• Gene ID - Mouse: ENSMUSG00000052593
• Gene ID - Rat: ENSRNOG00000060694
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADAM17 pAb (ATL-HPA051575) – 1 Found

He, Jiayue; Liu, Shuguang; Tan, Qi; Liu, Zhiying; Fu, Jiewen; Li, Ting; Wei, Chunli; Liu, Xiaoyan; Mei, Zhiqiang; Cheng, Jingliang; Wang, Kai; Fu, Junjiang. Antiviral Potential of Small Molecules Cordycepin, Thymoquinone, and N6, N6-Dimethyladenosine Targeting SARS-CoV-2 Entry Protein ADAM17. Molecules (Basel, Switzerland). 2022;27(24)