Anti ACY3 pAb (ATL-HPA048187 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA048187-25
  • Immunohistochemical staining of human cerebral cortex, colon, duodenum and liver using Anti-ACY3 antibody HPA048187 (A) shows similar protein distribution across tissues to independent antibody HPA039219 (B).
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ACY3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408962).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aspartoacylase (aminocyclase) 3
Gene Name: ACY3
Alternative Gene Name: ACY-3, HCBP1, MGC9740
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024866: 72%, ENSRNOG00000017901: 75%
Entrez Gene ID: 91703
Uniprot ID: Q96HD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCSLPVPQEPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSR
Gene Sequence MCSLPVPQEPLRRVAVTGGTHGNEMSGVYLARHWLHAPAELQRASFSAVPVLANPAATSGCRRYVDHDLNRTFTSSFLNSR
Gene ID - Mouse ENSMUSG00000024866
Gene ID - Rat ENSRNOG00000017901
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACY3 pAb (ATL-HPA048187 w/enhanced validation)
Datasheet Anti ACY3 pAb (ATL-HPA048187 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACY3 pAb (ATL-HPA048187 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACY3 pAb (ATL-HPA048187 w/enhanced validation)
Datasheet Anti ACY3 pAb (ATL-HPA048187 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACY3 pAb (ATL-HPA048187 w/enhanced validation)