Anti ACVR2A pAb (ATL-HPA046997)

Atlas Antibodies

SKU: ATL-HPA046997-25

• 

Protein Description: activin A receptor, type IIA
Gene Name: ACVR2A
Alternative Gene Name: ACTRII, ACVR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052155: 100%, ENSRNOG00000005334: 100%
Entrez Gene ID: 92
Uniprot ID: P27037
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYN
• Gene Sequence: CEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYN
• Gene ID - Mouse: ENSMUSG00000052155
• Gene ID - Rat: ENSRNOG00000005334
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.