Protein Description: ARP8 actin-related protein 8 homolog (yeast)
Gene Name: ACTR8
Alternative Gene Name: INO80N
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015971: 96%, ENSRNOG00000015280: 96%
Entrez Gene ID: 93973
Uniprot ID: Q9H981
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ACTR8
Alternative Gene Name: INO80N
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015971: 96%, ENSRNOG00000015280: 96%
Entrez Gene ID: 93973
Uniprot ID: Q9H981
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YLEIPLKDLKYYRCILLIPDIYNKQHVKELVNMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTRLCL |
| Documents & Links for Anti ACTR8 pAb (ATL-HPA065236) | |
| Datasheet | Anti ACTR8 pAb (ATL-HPA065236) Datasheet (External Link) |
| Vendor Page | Anti ACTR8 pAb (ATL-HPA065236) at Atlas |
| Documents & Links for Anti ACTR8 pAb (ATL-HPA065236) | |
| Datasheet | Anti ACTR8 pAb (ATL-HPA065236) Datasheet (External Link) |
| Vendor Page | Anti ACTR8 pAb (ATL-HPA065236) |