Anti ACTR3 pAb (ATL-HPA051683)

Atlas Antibodies

SKU: ATL-HPA051683-100

• 
• 

Protein Description: ARP3 actin-related protein 3 homolog (yeast)
Gene Name: ACTR3
Alternative Gene Name: ARP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026341: 100%, ENSRNOG00000003206: 100%
Entrez Gene ID: 10096
Uniprot ID: P61158
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDH
• Gene Sequence: KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDH
• Gene ID - Mouse: ENSMUSG00000026341
• Gene ID - Rat: ENSRNOG00000003206
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.