Anti ACSS3 pAb (ATL-HPA061517)

Atlas Antibodies

SKU:
ATL-HPA061517-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: acyl-CoA synthetase short-chain family member 3
Gene Name: ACSS3
Alternative Gene Name: FLJ21963
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035948: 95%, ENSRNOG00000004448: 95%
Entrez Gene ID: 79611
Uniprot ID: Q9H6R3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVK
Gene Sequence MDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVK
Gene ID - Mouse ENSMUSG00000035948
Gene ID - Rat ENSRNOG00000004448
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACSS3 pAb (ATL-HPA061517)
Datasheet Anti ACSS3 pAb (ATL-HPA061517) Datasheet (External Link)
Vendor Page Anti ACSS3 pAb (ATL-HPA061517) at Atlas Antibodies

Documents & Links for Anti ACSS3 pAb (ATL-HPA061517)
Datasheet Anti ACSS3 pAb (ATL-HPA061517) Datasheet (External Link)
Vendor Page Anti ACSS3 pAb (ATL-HPA061517)