Anti ACSM2A pAb (ATL-HPA057699)

Atlas Antibodies

SKU: ATL-HPA057699-25

• 
• 

Protein Description: acyl-CoA synthetase medium-chain family member 2A
Gene Name: ACSM2A
Alternative Gene Name: A-923A4.1, ACSM2, MGC150530
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030945: 60%, ENSRNOG00000042084: 64%
Entrez Gene ID: 123876
Uniprot ID: Q08AH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWAD
• Gene Sequence: LRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWAD
• Gene ID - Mouse: ENSMUSG00000030945
• Gene ID - Rat: ENSRNOG00000042084
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.