Anti ACSM1 pAb (ATL-HPA046291)

Atlas Antibodies

SKU: ATL-HPA046291-25

• 

Protein Description: acyl-CoA synthetase medium-chain family member 1
Gene Name: ACSM1
Alternative Gene Name: BUCS1, MACS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033533: 58%, ENSRNOG00000042084: 57%
Entrez Gene ID: 116285
Uniprot ID: Q08AH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
• Gene Sequence: HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
• Gene ID - Mouse: ENSMUSG00000033533
• Gene ID - Rat: ENSRNOG00000042084
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.