Anti ACSL3 pAb (ATL-HPA011315 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA011315-100
  • Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
  • Western blot analysis in human cell lines SK-MEL-30 and U-251MG using Anti-ACSL3 antibody. Corresponding ACSL3 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added

Product Description

Protein Description: acyl-CoA synthetase long-chain family member 3
Gene Name: ACSL3
Alternative Gene Name: ACS3, FACL3, PRO2194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032883: 91%, ENSRNOG00000014718: 90%
Entrez Gene ID: 2181
Uniprot ID: O95573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIM
Gene Sequence MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAVIM
Gene ID - Mouse ENSMUSG00000032883
Gene ID - Rat ENSRNOG00000014718
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti ACSL3 pAb (ATL-HPA011315 w/enhanced validation)
Datasheet Anti ACSL3 pAb (ATL-HPA011315 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACSL3 pAb (ATL-HPA011315 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACSL3 pAb (ATL-HPA011315 w/enhanced validation)
Datasheet Anti ACSL3 pAb (ATL-HPA011315 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACSL3 pAb (ATL-HPA011315 w/enhanced validation)