![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99248/178735/atl-hpa063916_anti-acpp-pab-atl-hpa063916-wenhanced-validation_60397__96890.1681134279.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: acid phosphatase, prostate
Gene Name: ACPP
Alternative Gene Name: ACP-3, ACP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032561: 73%, ENSRNOG00000011820: 70%
Entrez Gene ID: 55
Uniprot ID: P15309
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ACPP
Alternative Gene Name: ACP-3, ACP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032561: 73%, ENSRNOG00000011820: 70%
Entrez Gene ID: 55
Uniprot ID: P15309
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQGT |
| Documents & Links for Anti ACPP pAb (ATL-HPA063916 w/enhanced validation) | |
| Datasheet | Anti ACPP pAb (ATL-HPA063916 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACPP pAb (ATL-HPA063916 w/enhanced validation) at Atlas |
| Documents & Links for Anti ACPP pAb (ATL-HPA063916 w/enhanced validation) | |
| Datasheet | Anti ACPP pAb (ATL-HPA063916 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACPP pAb (ATL-HPA063916 w/enhanced validation) |