Anti ACOT2 pAb (ATL-HPA060170 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA060170-25

• 
• 

Protein Description: acyl-CoA thioesterase 2
Gene Name: ACOT2
Alternative Gene Name: Mte1, ZAP128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021226: 29%, ENSRNOG00000054763: 32%
Entrez Gene ID: 10965
Uniprot ID: P49753
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPAR
• Gene Sequence: MSNKLLSPHPHSVVLRSEFKMASSPAVLRASRLYQWSLKSSAQFLGSPQLRQVGQIIRVPAR
• Gene ID - Mouse: ENSMUSG00000021226
• Gene ID - Rat: ENSRNOG00000054763
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.