Anti ACKR3 pAb (ATL-HPA049718)

Atlas Antibodies

SKU: ATL-HPA049718-25

• 

Protein Description: atypical chemokine receptor 3
Gene Name: ACKR3
Alternative Gene Name: CMKOR1, CXCR7, GPR159, RDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044337: 84%, ENSRNOG00000019622: 84%
Entrez Gene ID: 57007
Uniprot ID: P25106
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY
• Gene Sequence: LHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLY
• Gene ID - Mouse: ENSMUSG00000044337
• Gene ID - Rat: ENSRNOG00000019622
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACKR3 pAb (ATL-HPA049718) – 1 Found

Fan, Li-Ching; Jeng, Yung-Ming; Lu, Yueh-Tong; Lien, Huang-Chun. SPOCK1 Is a Novel Transforming Growth Factor-β-Induced Myoepithelial Marker That Enhances Invasion and Correlates with Poor Prognosis in Breast Cancer. Plos One. 11(9):e0162933.