Protein Description: angiotensin I converting enzyme
Gene Name: ACE
Alternative Gene Name: ACE1, CD143, DCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020681: 81%, ENSRNOG00000062101: 83%
Entrez Gene ID: 1636
Uniprot ID: P12821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ACE
Alternative Gene Name: ACE1, CD143, DCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020681: 81%, ENSRNOG00000062101: 83%
Entrez Gene ID: 1636
Uniprot ID: P12821
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KTATCWSLDPDLTNILASSRSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDLEHLYQQ |
| Documents & Links for Anti ACE pAb (ATL-HPA069790) | |
| Datasheet | Anti ACE pAb (ATL-HPA069790) Datasheet (External Link) |
| Vendor Page | Anti ACE pAb (ATL-HPA069790) at Atlas |
| Documents & Links for Anti ACE pAb (ATL-HPA069790) | |
| Datasheet | Anti ACE pAb (ATL-HPA069790) Datasheet (External Link) |
| Vendor Page | Anti ACE pAb (ATL-HPA069790) |