Anti ACD pAb (ATL-HPA057660)
Atlas Antibodies
- SKU:
- ATL-HPA057660-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ACD
Alternative Gene Name: Pip1, Ptop, Tint1, Tpp1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038000: 80%, ENSRNOG00000038973: 79%
Entrez Gene ID: 65057
Uniprot ID: Q96AP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVA |
Gene Sequence | IRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEKEFGFRGTEGRLLLLQDCGVHVQVA |
Gene ID - Mouse | ENSMUSG00000038000 |
Gene ID - Rat | ENSRNOG00000038973 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACD pAb (ATL-HPA057660) | |
Datasheet | Anti ACD pAb (ATL-HPA057660) Datasheet (External Link) |
Vendor Page | Anti ACD pAb (ATL-HPA057660) at Atlas Antibodies |
Documents & Links for Anti ACD pAb (ATL-HPA057660) | |
Datasheet | Anti ACD pAb (ATL-HPA057660) Datasheet (External Link) |
Vendor Page | Anti ACD pAb (ATL-HPA057660) |