Anti ACD pAb (ATL-HPA049411)

Atlas Antibodies

SKU: ATL-HPA049411-25

• 

Protein Description: adrenocortical dysplasia homolog (mouse)
Gene Name: ACD
Alternative Gene Name: Pip1, Ptop, Tint1, Tpp1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038000: 37%, ENSRNOG00000038973: 48%
Entrez Gene ID: 65057
Uniprot ID: Q96AP0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLSLTLIASPPSSPS
• Gene Sequence: TLEGPCTAPPVTHWAASRCKATGEAVYTVPSSMLCISENDQLILSSLGPCQRTQGPELPPPDPALQDLSLTLIASPPSSPS
• Gene ID - Mouse: ENSMUSG00000038000
• Gene ID - Rat: ENSRNOG00000038973
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.