Anti ACBD3 pAb (ATL-HPA015594 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA015594-25

• 
• 
• 

Protein Description: acyl-CoA binding domain containing 3
Gene Name: ACBD3
Alternative Gene Name: GCP60, GOCAP1, GOLPH1, PAP7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026499: 89%, ENSRNOG00000003185: 86%
Entrez Gene ID: 64746
Uniprot ID: Q9H3P7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVIT
• Gene Sequence: QYPGNYEQQQILIRQLQEQHYQQYMQQLYQVQLAQQQAALQKQQEVVVAGSSLPTSSKVNATVPSNMMSVNGQAKTHTDSSEKELEPEAAEEALENGPKESLPVIAAPSMWTRPQIKDFKEKIQQDADSVIT
• Gene ID - Mouse: ENSMUSG00000026499
• Gene ID - Rat: ENSRNOG00000003185
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACBD3 pAb (ATL-HPA015594 w/enhanced validation) – 5 Found

Daňhelovská, Tereza; Zdražilová, Lucie; Štufková, Hana; Vanišová, Marie; Volfová, Nikol; Křížová, Jana; Kuda, Ondřej; Sládková, Jana; Tesařová, Markéta. Knock-Out of ACBD3 Leads to Dispersed Golgi Structure, but Unaffected Mitochondrial Functions in HEK293 and HeLa Cells. International Journal Of Molecular Sciences. 2021;22(14) 

Téoulé, François; Brisac, Cynthia; Pelletier, Isabelle; Vidalain, Pierre-Olivier; Jégouic, Sophie; Mirabelli, Carmen; Bessaud, Maël; Combelas, Nicolas; Autret, Arnaud; Tangy, Frédéric; Delpeyroux, Francis; Blondel, Bruno. The Golgi protein ACBD3, an interactor for poliovirus protein 3A, modulates poliovirus replication. Journal Of Virology. 2013;87(20):11031-46. 

Kim, Heon Seok; Lee, Kyungjin; Kim, Seong-Jun; Cho, Sungchan; Shin, Hye Jin; Kim, Chonsaeng; Kim, Jin-Soo. Arrayed CRISPR screen with image-based assay reliably uncovers host genes required for coxsackievirus infection. Genome Research. 2018;28(6):859-868. 

Berndsen, Kerryn; Lis, Pawel; Yeshaw, Wondwossen M; Wawro, Paulina S; Nirujogi, Raja S; Wightman, Melanie; Macartney, Thomas; Dorward, Mark; Knebel, Axel; Tonelli, Francesca; Pfeffer, Suzanne R; Alessi, Dario R. PPM1H phosphatase counteracts LRRK2 signaling by selectively dephosphorylating Rab proteins. Elife. 2019;8( 31663853) 

Shin, Hye Jin; Ku, Keun Bon; Kim, Soojin; Kim, Heon Seok; Kim, Yeon-Soo; Kim, Bum-Tae; Kim, Seong-Jun; Kim, Chonsaeng. A Crucial Role of ACBD3 Required for Coxsackievirus Infection in Animal Model Developed by AAV-Mediated CRISPR Genome Editing Technique. Viruses. 2021;13(2)