Anti ACAP3 pAb (ATL-HPA049317)

Atlas Antibodies

SKU: ATL-HPA049317-25

• 

Protein Description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
Gene Name: ACAP3
Alternative Gene Name: CENTB5, KIAA1716
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029033: 90%, ENSRNOG00000022307: 90%
Entrez Gene ID: 116983
Uniprot ID: Q96P50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKLCSGMVEAGKAYVSTSRLFVSGVRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLQSFVKE
• Gene Sequence: VKLCSGMVEAGKAYVSTSRLFVSGVRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLQSFVKE
• Gene ID - Mouse: ENSMUSG00000029033
• Gene ID - Rat: ENSRNOG00000022307
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.