Protein Description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 1
Gene Name: ACAP1
Alternative Gene Name: CENTB1, KIAA0050
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001588: 90%, ENSRNOG00000015674: 89%
Entrez Gene ID: 9744
Uniprot ID: Q15027
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ACAP1
Alternative Gene Name: CENTB1, KIAA0050
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001588: 90%, ENSRNOG00000015674: 89%
Entrez Gene ID: 9744
Uniprot ID: Q15027
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK |
Documents & Links for Anti ACAP1 pAb (ATL-HPA075570) | |
Datasheet | Anti ACAP1 pAb (ATL-HPA075570) Datasheet (External Link) |
Vendor Page | Anti ACAP1 pAb (ATL-HPA075570) at Atlas |
Documents & Links for Anti ACAP1 pAb (ATL-HPA075570) | |
Datasheet | Anti ACAP1 pAb (ATL-HPA075570) Datasheet (External Link) |
Vendor Page | Anti ACAP1 pAb (ATL-HPA075570) |