Anti ACAP1 pAb (ATL-HPA075570)

Atlas Antibodies

SKU: ATL-HPA075570-25

• 
• 

Protein Description: ArfGAP with coiled-coil, ankyrin repeat and PH domains 1
Gene Name: ACAP1
Alternative Gene Name: CENTB1, KIAA0050
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001588: 90%, ENSRNOG00000015674: 89%
Entrez Gene ID: 9744
Uniprot ID: Q15027
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK
• Gene Sequence: QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK
• Gene ID - Mouse: ENSMUSG00000001588
• Gene ID - Rat: ENSRNOG00000015674
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.