Anti ACACA pAb (ATL-HPA063018)
Atlas Antibodies
- SKU:
- ATL-HPA063018-100
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/98990/178374/atl-hpa063018_anti-acaca-pab-atl-hpa063018_60036__22535.1681133803.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: ACACA
Alternative Gene Name: ACAC, ACC, ACC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020532: 94%, ENSRNOG00000008237: 31%
Entrez Gene ID: 31
Uniprot ID: Q13085
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL |
| Gene Sequence | MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL |
| Gene ID - Mouse | ENSMUSG00000020532 |
| Gene ID - Rat | ENSRNOG00000008237 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACACA pAb (ATL-HPA063018) | |
| Datasheet | Anti ACACA pAb (ATL-HPA063018) Datasheet (External Link) |
| Vendor Page | Anti ACACA pAb (ATL-HPA063018) at Atlas Antibodies |
| Documents & Links for Anti ACACA pAb (ATL-HPA063018) | |
| Datasheet | Anti ACACA pAb (ATL-HPA063018) Datasheet (External Link) |
| Vendor Page | Anti ACACA pAb (ATL-HPA063018) |
| Citations for Anti ACACA pAb (ATL-HPA063018) – 1 Found |
| Xiahou, Zhikai; Han, Jun. Effects of dehydroabietic acid on nontarget lipidomics and proteomics of HepG2. Frontiers In Pharmacology. 13( 36532744):1015240. PubMed |