Anti ABR pAb (ATL-HPA054824)

Atlas Antibodies

SKU:
ATL-HPA054824-100
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in a dot like pattern in neuronal cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: active BCR-related
Gene Name: ABR
Alternative Gene Name: MDB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017631: 98%, ENSRNOG00000056837: 98%
Entrez Gene ID: 29
Uniprot ID: Q12979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLL
Gene Sequence EESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLL
Gene ID - Mouse ENSMUSG00000017631
Gene ID - Rat ENSRNOG00000056837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABR pAb (ATL-HPA054824)
Datasheet Anti ABR pAb (ATL-HPA054824) Datasheet (External Link)
Vendor Page Anti ABR pAb (ATL-HPA054824) at Atlas Antibodies

Documents & Links for Anti ABR pAb (ATL-HPA054824)
Datasheet Anti ABR pAb (ATL-HPA054824) Datasheet (External Link)
Vendor Page Anti ABR pAb (ATL-HPA054824)