Anti ABHD18 pAb (ATL-HPA051676)

Atlas Antibodies

SKU:
ATL-HPA051676-25
  • Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nuclear membrane.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: abhydrolase domain containing 18
Gene Name: ABHD18
Alternative Gene Name: C4orf29, FLJ21106
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037818: 57%, ENSRNOG00000013692: 57%
Entrez Gene ID: 80167
Uniprot ID: Q0P651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPMPLIPCLSWSTASGVFTTTDSFKMGQEFVKHFTSSADKLTNLNLVSRTLNLDISNQVVSQKPADCHNSSKTSVSATSEGLLLQDTSKMKRFNQRLSTN
Gene Sequence KPMPLIPCLSWSTASGVFTTTDSFKMGQEFVKHFTSSADKLTNLNLVSRTLNLDISNQVVSQKPADCHNSSKTSVSATSEGLLLQDTSKMKRFNQRLSTN
Gene ID - Mouse ENSMUSG00000037818
Gene ID - Rat ENSRNOG00000013692
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABHD18 pAb (ATL-HPA051676)
Datasheet Anti ABHD18 pAb (ATL-HPA051676) Datasheet (External Link)
Vendor Page Anti ABHD18 pAb (ATL-HPA051676) at Atlas Antibodies

Documents & Links for Anti ABHD18 pAb (ATL-HPA051676)
Datasheet Anti ABHD18 pAb (ATL-HPA051676) Datasheet (External Link)
Vendor Page Anti ABHD18 pAb (ATL-HPA051676)