Protein Description: abhydrolase domain containing 18
Gene Name: ABHD18
Alternative Gene Name: C4orf29, FLJ21106
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037818: 57%, ENSRNOG00000013692: 57%
Entrez Gene ID: 80167
Uniprot ID: Q0P651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABHD18
Alternative Gene Name: C4orf29, FLJ21106
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037818: 57%, ENSRNOG00000013692: 57%
Entrez Gene ID: 80167
Uniprot ID: Q0P651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KPMPLIPCLSWSTASGVFTTTDSFKMGQEFVKHFTSSADKLTNLNLVSRTLNLDISNQVVSQKPADCHNSSKTSVSATSEGLLLQDTSKMKRFNQRLSTN |
| Documents & Links for Anti ABHD18 pAb (ATL-HPA051676) | |
| Datasheet | Anti ABHD18 pAb (ATL-HPA051676) Datasheet (External Link) |
| Vendor Page | Anti ABHD18 pAb (ATL-HPA051676) at Atlas |
| Documents & Links for Anti ABHD18 pAb (ATL-HPA051676) | |
| Datasheet | Anti ABHD18 pAb (ATL-HPA051676) Datasheet (External Link) |
| Vendor Page | Anti ABHD18 pAb (ATL-HPA051676) |