Anti ABHD18 pAb (ATL-HPA050168)

Atlas Antibodies

SKU: ATL-HPA050168-25

• 
• 

Protein Description: abhydrolase domain containing 18
Gene Name: ABHD18
Alternative Gene Name: C4orf29, FLJ21106
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037818: 86%, ENSRNOG00000013692: 88%
Entrez Gene ID: 80167
Uniprot ID: Q0P651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKSGYTSRNPQSYHLLSKEQSRNSLRKESLIFMKGVMDECTHVANFSVPVDPSLIIVVQAKEDAYIPRTGVRSLQEIWPGCEIRYL
• Gene Sequence: NKSGYTSRNPQSYHLLSKEQSRNSLRKESLIFMKGVMDECTHVANFSVPVDPSLIIVVQAKEDAYIPRTGVRSLQEIWPGCEIRYL
• Gene ID - Mouse: ENSMUSG00000037818
• Gene ID - Rat: ENSRNOG00000013692
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.