Anti ABHD17A pAb (ATL-HPA047226)

Atlas Antibodies

SKU: ATL-HPA047226-100

• 
• 
• 

Protein Description: abhydrolase domain containing 17A
Gene Name: ABHD17A
Alternative Gene Name: C19orf27, FAM108A1, MGC5244
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053536: 31%, ENSRNOG00000050289: 31%
Entrez Gene ID: 81926
Uniprot ID: Q96GS6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARQGHQAQGGHPQLAWVGRLGDSNNPAPGGCLLGESWGTGAALACGYIHLLARYT
• Gene Sequence: ARQGHQAQGGHPQLAWVGRLGDSNNPAPGGCLLGESWGTGAALACGYIHLLARYT
• Gene ID - Mouse: ENSMUSG00000053536
• Gene ID - Rat: ENSRNOG00000050289
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.