Anti ABHD16A pAb (ATL-HPA058606)

Atlas Antibodies

SKU: ATL-HPA058606-25

• 

Protein Description: abhydrolase domain containing 16A
Gene Name: ABHD16A
Alternative Gene Name: BAT5, D6S82E, NG26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007036: 91%, ENSRNOG00000056637: 93%
Entrez Gene ID: 7920
Uniprot ID: O95870
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIM
• Gene Sequence: GLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPEDIM
• Gene ID - Mouse: ENSMUSG00000007036
• Gene ID - Rat: ENSRNOG00000056637
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.