Anti ABHD11 pAb (ATL-HPA049641)

Atlas Antibodies

SKU: ATL-HPA049641-25

• 
• 
• 

Protein Description: abhydrolase domain containing 11
Gene Name: ABHD11
Alternative Gene Name: PP1226, WBSCR21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040532: 70%, ENSRNOG00000018910: 70%
Entrez Gene ID: 83451
Uniprot ID: Q8NFV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIMRLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV
• Gene Sequence: RFVWRVNLDALTQHLDKILAFPQRQESYLGPTLFLLGGNSQFVHPSHHPEIMRLFPRAQMQTVPNAGHWIHADRPQDFIAAIRGFLV
• Gene ID - Mouse: ENSMUSG00000040532
• Gene ID - Rat: ENSRNOG00000018910
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.