Protein Description: abhydrolase domain containing 10
Gene Name: ABHD10
Alternative Gene Name: FLJ11342
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033157: 78%, ENSRNOG00000043107: 75%
Entrez Gene ID: 55347
Uniprot ID: Q9NUJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ABHD10
Alternative Gene Name: FLJ11342
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033157: 78%, ENSRNOG00000043107: 75%
Entrez Gene ID: 55347
Uniprot ID: Q9NUJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | STLGKWRKDVLSIIDDLADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAADTLVTKFNQLPVELKKEVEMKGVWSM |
| Documents & Links for Anti ABHD10 pAb (ATL-HPA066081) | |
| Datasheet | Anti ABHD10 pAb (ATL-HPA066081) Datasheet (External Link) |
| Vendor Page | Anti ABHD10 pAb (ATL-HPA066081) at Atlas |
| Documents & Links for Anti ABHD10 pAb (ATL-HPA066081) | |
| Datasheet | Anti ABHD10 pAb (ATL-HPA066081) Datasheet (External Link) |
| Vendor Page | Anti ABHD10 pAb (ATL-HPA066081) |