Anti ABCD3 pAb (ATL-HPA032027 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA032027-25

• 
• 

Product Description

Protein Description: ATP-binding cassette, sub-family D (ALD), member 3
Gene Name: ABCD3
Alternative Gene Name: PMP70, PXMP1, ZWS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028127: 96%, ENSRNOG00000011929: 96%
Entrez Gene ID: 5825
Uniprot ID: P28288
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS
• Gene Sequence: VEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS
• Gene ID - Mouse: ENSMUSG00000028127
• Gene ID - Rat: ENSRNOG00000011929
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Citations

Citations for Anti ABCD3 pAb (ATL-HPA032027 w/enhanced validation) – 3 Found

Reams, R Renee; Jones-Triche, Jacqueline; Chan, Owen T M; Hernandez, Brenda Y; Soliman, Karam F A; Yates, Clayton. Immunohistological analysis of ABCD3 expression in Caucasian and African American prostate tumors. Biomed Research International. 2015( 25802834):132981. 

Assadi, Ghazaleh; Vesterlund, Liselotte; Bonfiglio, Ferdinando; Mazzurana, Luca; Cordeddu, Lina; Schepis, Danika; Mjösberg, Jenny; Ruhrmann, Sabrina; Fabbri, Alessia; Vukojevic, Vladana; Percipalle, Piergiorgio; Salomons, Florian A; Laurencikiene, Jurga; Törkvist, Leif; Halfvarson, Jonas; D'Amato, Mauro. Functional Analyses of the Crohn's Disease Risk Gene LACC1. Plos One. 11(12):e0168276. 

Zhang, Yujiao; Zhang, Yaqi; Wang, Jiping; Yang, Jiyuan; Yang, Guodong. Abnormal expression of ABCD3 is an independent prognostic factor for colorectal cancer. Oncology Letters. 2020;19(5):3567-3577.