Anti ABCC5 pAb (ATL-HPA052295)

Atlas Antibodies

SKU:
ATL-HPA052295-25
  • Immunohistochemical staining of human kidney shows strong membranous positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family C (CFTR/MRP), member 5
Gene Name: ABCC5
Alternative Gene Name: EST277145, MOAT-C, MRP5, SMRP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022822: 80%, ENSRNOG00000029178: 82%
Entrez Gene ID: 10057
Uniprot ID: O15440
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERL
Gene Sequence SPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERL
Gene ID - Mouse ENSMUSG00000022822
Gene ID - Rat ENSRNOG00000029178
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABCC5 pAb (ATL-HPA052295)
Datasheet Anti ABCC5 pAb (ATL-HPA052295) Datasheet (External Link)
Vendor Page Anti ABCC5 pAb (ATL-HPA052295) at Atlas Antibodies

Documents & Links for Anti ABCC5 pAb (ATL-HPA052295)
Datasheet Anti ABCC5 pAb (ATL-HPA052295) Datasheet (External Link)
Vendor Page Anti ABCC5 pAb (ATL-HPA052295)