Anti ABCB10 pAb (ATL-HPA055175)
Atlas Antibodies
- SKU:
- ATL-HPA055175-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ABCB10
Alternative Gene Name: EST20237, M-ABC2, MTABC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031974: 96%, ENSRNOG00000017993: 94%
Entrez Gene ID: 23456
Uniprot ID: Q9NRK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTE |
Gene Sequence | MQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTE |
Gene ID - Mouse | ENSMUSG00000031974 |
Gene ID - Rat | ENSRNOG00000017993 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ABCB10 pAb (ATL-HPA055175) | |
Datasheet | Anti ABCB10 pAb (ATL-HPA055175) Datasheet (External Link) |
Vendor Page | Anti ABCB10 pAb (ATL-HPA055175) at Atlas Antibodies |
Documents & Links for Anti ABCB10 pAb (ATL-HPA055175) | |
Datasheet | Anti ABCB10 pAb (ATL-HPA055175) Datasheet (External Link) |
Vendor Page | Anti ABCB10 pAb (ATL-HPA055175) |