Anti ABCB10 pAb (ATL-HPA055175)

Atlas Antibodies

SKU:
ATL-HPA055175-25
  • Immunohistochemical staining of human bone marrow shows distinct cytoplasmic positivity in subsets of hematopoietic cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family B (MDR/TAP), member 10
Gene Name: ABCB10
Alternative Gene Name: EST20237, M-ABC2, MTABC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031974: 96%, ENSRNOG00000017993: 94%
Entrez Gene ID: 23456
Uniprot ID: Q9NRK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTE
Gene Sequence MQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTE
Gene ID - Mouse ENSMUSG00000031974
Gene ID - Rat ENSRNOG00000017993
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABCB10 pAb (ATL-HPA055175)
Datasheet Anti ABCB10 pAb (ATL-HPA055175) Datasheet (External Link)
Vendor Page Anti ABCB10 pAb (ATL-HPA055175) at Atlas Antibodies

Documents & Links for Anti ABCB10 pAb (ATL-HPA055175)
Datasheet Anti ABCB10 pAb (ATL-HPA055175) Datasheet (External Link)
Vendor Page Anti ABCB10 pAb (ATL-HPA055175)