Anti ABCA9 pAb (ATL-HPA052113)

Atlas Antibodies

SKU: ATL-HPA052113-25

• 

Protein Description: ATP binding cassette subfamily A member 9
Gene Name: ABCA9
Alternative Gene Name: EST640918
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041797: 84%, ENSRNOG00000059326: 79%
Entrez Gene ID: 10350
Uniprot ID: Q8IUA7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEYGYR
• Gene Sequence: NCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEYGYR
• Gene ID - Mouse: ENSMUSG00000041797
• Gene ID - Rat: ENSRNOG00000059326
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.