Anti ABCA8 pAb (ATL-HPA044914 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA044914-25
  • Immunohistochemistry analysis in human ovary and pancreas tissues using Anti-ABCA8 antibody. Corresponding ABCA8 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line ASC TERT1 shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATP-binding cassette, sub-family A (ABC1), member 8
Gene Name: ABCA8
Alternative Gene Name: KIAA0822
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020620: 55%, ENSRNOG00000004040: 55%
Entrez Gene ID: 10351
Uniprot ID: O94911
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEVLGLPDEESIKEFTANYPEEIVRVTFTNTYSYHLKFLLGHGMPAKKEHKDHTAHCYETNEDVYCEVSVFWKEGFVA
Gene Sequence KEVLGLPDEESIKEFTANYPEEIVRVTFTNTYSYHLKFLLGHGMPAKKEHKDHTAHCYETNEDVYCEVSVFWKEGFVA
Gene ID - Mouse ENSMUSG00000020620
Gene ID - Rat ENSRNOG00000004040
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ABCA8 pAb (ATL-HPA044914 w/enhanced validation)
Datasheet Anti ABCA8 pAb (ATL-HPA044914 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABCA8 pAb (ATL-HPA044914 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ABCA8 pAb (ATL-HPA044914 w/enhanced validation)
Datasheet Anti ABCA8 pAb (ATL-HPA044914 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ABCA8 pAb (ATL-HPA044914 w/enhanced validation)



Citations for Anti ABCA8 pAb (ATL-HPA044914 w/enhanced validation) – 1 Found
Yang, Andrew C; Vest, Ryan T; Kern, Fabian; Lee, Davis P; Agam, Maayan; Maat, Christina A; Losada, Patricia M; Chen, Michelle B; Schaum, Nicholas; Khoury, Nathalie; Toland, Angus; Calcuttawala, Kruti; Shin, Heather; Pálovics, Róbert; Shin, Andrew; Wang, Elizabeth Y; Luo, Jian; Gate, David; Schulz-Schaeffer, Walter J; Chu, Pauline; Siegenthaler, Julie A; McNerney, M Windy; Keller, Andreas; Wyss-Coray, Tony. A human brain vascular atlas reveals diverse mediators of Alzheimer's risk. Nature. 2022;603(7903):885-892.  PubMed